PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000202241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 222aa    MW: 25375.4 Da    PI: 10.4596
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000202241genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP76.38.6e-24160214256
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqak 56 
                     g+kdrh k++T +g+RdRRvRls+++a++++dLq++LG+ ++sk ++WLl +  
  MDP0000202241 160 FGGKDRHGKVCTIRGLRDRRVRLSVPTAIQLYDLQERLGLNQPSKVVDWLLDDDH 214
                    689************************************************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136923.463162220IPR017887Transcription factor TCP subgroup
PfamPF036342.8E-22162218IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MGWLSMRLFK DVMKWYHAVI KRGITHYTPE SVVALSLARV VPVSIFFRLF REPTRFVLTP  60
LCKSNIPLHH CGKEKTVEEI YYQLAKNPTT IGCRKLENGL PEGGEEQQKY SGGRLWSSTT  120
SRECVAKEAN KISSNPNLSR SSTPWPRLKD PRIVHASRAF GGKDRHGKVC TIRGLRDRRV  180
RLSVPTAIQL YDLQERLGLN QPSKVVDWLL DDDHNQVRLL LG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.163241e-113fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5010671e-44KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348175.11e-91PREDICTED: transcription factor TCP13-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.16e-36plastid transcription factor 1